PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008221592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 288aa    MW: 33139.5 Da    PI: 7.5694
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008221592.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-5391341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yLk++++++++++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nrat sgyWkatg+dk+++s 
  XP_008221592.1   9 LPPGFRFHPTDEELIMFYLKNQATSRPCPV-SIIPEVDLYKFDPWQLPEKAEFGENEWYFFTPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS- 101
                     79****************************.89***************99999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + + vg+kk Lvfy+g+ pkg+k+dW+mheyrl
  XP_008221592.1 102 GAKYVGVKKALVFYQGKPPKGVKSDWIMHEYRL 134
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-654161IPR003441NAC domain
PROSITE profilePS5100560.6659161IPR003441NAC domain
PfamPF023651.3E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEAKHSSELP PGFRFHPTDE ELIMFYLKNQ ATSRPCPVSI IPEVDLYKFD PWQLPEKAEF  60
GENEWYFFTP RDRKYPNGVR PNRATVSGYW KATGTDKAIY SGAKYVGVKK ALVFYQGKPP  120
KGVKSDWIMH EYRLSDSRKQ ANKQLGSMRL DDWVLCRIYK KRHLGKAYLD QKVEEEDPIT  180
DPKIEITAAN NHEEQMMLKF PRTCSITSLL EMDYLAPISQ LLSENSSYDF QNNLASAGNA  240
GHAQMFQFGE MPYQSTTDTA KFQVTQSCPS NQPWFANPVH NLNGLDRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-6921638170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008221592.10.0PREDICTED: NAC transcription factor 29
SwissprotO492551e-114NAC29_ARATH; NAC transcription factor 29
TrEMBLM5XSI20.0M5XSI2_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s08850.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-115NAC-like, activated by AP3/PI